PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_300AB5CC9.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 1670aa    MW: 179590 Da    PI: 6.5319
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_300AB5CC9.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.3e-09712754347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            +WT eE e + +  + +G++ +++I++ ++ ++t  +c+++++k+
  Traes_1DS_300AB5CC9.2 712 PWTHEEKEVFMQMLASFGKN-FSKISNFLQ-HKTTADCVEFYYKH 754
                            8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-14695757IPR009057Homeodomain-like
PROSITE profilePS5129314.727708759IPR017884SANT domain
SMARTSM007172.2E-8709757IPR001005SANT/Myb domain
PfamPF002491.5E-6711754IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-7711756IPR009057Homeodomain-like
PROSITE profilePS5129314.846919970IPR017884SANT domain
SMARTSM007176.9E-5920968IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-8923965IPR009057Homeodomain-like
CDDcd001675.22E-4924962No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1670 aa     Download sequence    Send to blast
PLXPDEPLGY TPSRSDRYWL EEDPPAGYKG FSRYGGGGGR RDGRDLRGSY RRSPFRSYGG  60
DFPRGHQEPP PPPPLRRSPL RSVAVPICYD PPSDRADRED KEHQPRATPW RPLRRRESRS  120
DAADAAGAGP LSARQSATAG AASEKNAPSQ SAAVADSQSA EEETPRKKPR LGWGQGLAKY  180
EKQKVPGSSE SAEPVAEGSP GGVEQKEVEG APAPALCASP VAAPAAQPSA PALCASPVAA  240
PAAPSAPPSS SPVPEDKSCE LTTNTVTVSN KDIPGAEVQA YNDEIPIKLG QLDGDRIGSL  300
ANVLAELLQH EDSCSGDSRR LTNSSKLLLL KENIARELEK TELEIDSLEC ELKSVSTESE  360
NKALEDAQNP SPSSGTSKIL AKPATSKVLA KPETSKVLAK PEICGTSSSP KEQGVLTPCK  420
LSVEQEADAN GVDLMDVVTA PVRGVTAVSS GESVACPGVV AEAQVAVAAD VAPLKPSEGT  480
GSQIDAHCPR QEPSLSHDNV SSMKADGSNA LSTRQCSHHN DNRNLIPSII AVNNDIAKEF  540
NELVFKPLPA GQPCLGLSSQ MKNDLSVRKK LCMHKNRLRF KEQALTFKFK VLRHLWKEDV  600
RLLSVRKQRP KSNKRTDQSN RASQSGSQRQ RSSNRSRLGM PAGNLSTFPT TEISDVANKM  660
FTEFQFKRCR NYLKMPALII DEKEKESASF VSKNGLIEDP VSVEKERSVI NPWTHEEKEV  720
FMQMLASFGK NFSKISNFLQ HKTTADCVEF YYKHHKSDSF REVKKLLDLR QQQPTGNYLG  780
TKSGKKWNPE NAASLDMLGN AASVVAAHGL DYANRVEKDT EKSIIRTSCR SDVSAVAKGS  840
LDKDGIANVS LHERESVAAD VLAGICGTLS PEGMGSCITS SADHGQKIGA TRMEYLIATP  900
EADKSFDEED DLSDQECEVD SVDWNDNEKS LFIEALNNHG KDFARISSYV KSKSYEQCKV  960
FFSKARISLG LDLIYQQTTD TGLPTGDASG GRSDTDEACA AEMDSPICST QSPVEMEMEV  1020
CPSADKTLQG HLLSGITFKQ SETDRSDGPD IVDLTFEEGE IKAEDTNNCN IPVHHGQSSE  1080
ATHQSTPSCA PIDINSSEST GSMENREHSN QVSVHGNGAM ASSTEQSVGA HLEISSSLHN  1140
VEVIEPSKAS EKICTQVSSR EHAPESCAPS SAGNLTTPVF LPGVIQSSNV YEGICTKESS  1200
VERPSQQAPL SAHMKAGNLT LSVCLPGEQS SKVSSIEGPS KHAPESVHVK AGNLAPSVCL  1260
PGESGSKENV AHFPDMAGVS CIRPAFTSSY QQSVPTDLLP AKPKSQVTPL TPKDLMPVQF  1320
SSDLPDPTSI RFEGIASITS PNFGDHANRV SNTPGPKDMN KFPVFNEQSR SQHDVLFRNI  1380
DGYLQHRQNH HLAVDIPAFS DSTVSGSVGI SHPDQFTITK YQNGRSGSSG LSSSSAGFLM  1440
NGSSKELREG QLKPCSHKAS TESCDQVKRP GDVKLFGKIL SHQSSLQSSG SSSNATRSKP  1500
PPPTTAAGLL GSGMDRMVYS SRPTNTAHIG QDERVVRSYT HLDGSTAQPE SSLFRVAKCQ  1560
RSSLASVPFY SAKNGTLGVF AEYQQPLRQQ LPSDPKRLES YADLQKRNGM ELISGFQQQQ  1620
QPGKAARLGG AGILVSPVSD PVAALKAQYG SSSKFLGKDA DHPWKDIGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C7e-16670761494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D7e-16670761494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLW5AKN80.0W5AKN8_WHEAT; Uncharacterized protein
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.15e-70MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]